Because saving meals on Instagram isn't meal planning
Get personalised meal plans, groceries that fit your budget, and everything delivered, so your saved recipes finally become dinner. Healthy, time-saving, and surprisingly easy.
EatingEatingwellwellshouldn'tshouldn'tfeelfeellikelikeaachore.chore.EndlessEndlessscrollingscrollingthroughthroughmaddeningmaddeningad-riddenad-riddenreciperecipewebsites,websites,scribblingscribblingdowndownshoppingshoppinglists,lists,andandtrawlingtrawlingbusybusyaislesaislesforforingredients.ingredients.It'sIt's2025.2025.WhyWhyisn'tisn'ttherethereaabetterbetterway?way?FlamyayFlamyaylearnslearnswhatwhatyouyoulike,like,createscreatesdeliciousdeliciousweeklyweeklymealmealplansplansforforthethewholewholefamily,family,andanddeliversdeliversfreshfreshingredientsingredientsfromfromyouryourfavouritefavouritesupermarketssupermarketsdirectlydirectlytotoyouryourdoor.door.
Groceries and prices from the stores you already know
How flamyay works
From plan to plate in 4 easy steps
1
Tell us about you
Share your dietary preferences, restrictions, household size, and cooking habits. Whether you're keto, vegetarian, have allergies, want to eat more protein, or just really hate broccoli—we've got you covered!
2
Personalised meal plans
Choose your meals or let us automatically create a plan you'll love. Explore our diverse selection of recipes and import the ones you already know and love from anywhere. You're in control, as much or as little as you like.
3
Smart shopping, easy ordering
Receive an automated shopping list with real-time supermarket price comparisons, so you always get the best deal. Then, relax as groceries are delivered directly to your door or collect them in-store if you prefer.
4
Cook, eat, and enjoy!
Experience the joy of cooking delicious, healthy meals with easy-to-follow recipes suited for all skill levels and schedules. Less time worrying about meals, more time enjoying them